2ar7/5/1:A/1:B

Sequences

>2ar7-a5-m1-cA (length=221) [Search sequence]

KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLL
VPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRL
SRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIE
LYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL

>2ar7-a5-m1-cB (length=221) [Search sequence]

Structure information

PDB ID	2ar7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human adenylate kinase 4, AK4
Assembly ID	5
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P27144	P27144
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2ar7-a5-m1-cA_2ar7-a5-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2ar7-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2ar7/3/1:A/1:B 2ar7/3/2:A/2:B 2ar7/4/1:A/1:B 2ar7/4/3:A/3:B
Other dimers with similar sequences but different poses	2ar7/3/1:A/2:B 2ar7/3/1:B/2:A 2ar7/7/1:B/2:B 2ar7/3/1:B/2:B 2ar7/4/1:A/3:A 2ar7/6/1:A/3:A 3ndp/3/1:B/2:B 3ndp/3/1:A/2:A 3ndp/3/2:B/2:A 3ndp/3/1:B/1:A 3ndp/3/2:B/1:A 3ndp/3/1:B/2:A