2ask/3/3:A/3:B

Sequences
>2ask-a3-m3-cA (length=101) [Search sequence]
ARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPG
SRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
>2ask-a3-m3-cB (length=101) [Search sequence]
ARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPG
SRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Structure information
PDB ID 2ask (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of human Artemin
Assembly ID 3
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 144
Sequence identity between the two chains 1.0
PubMed citation 16734417
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession Q5T4W7 Q5T4W7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2askA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ask-a3-m3-cA_2ask-a3-m3-cB.pdb.gz
Full biological assembly
Download: 2ask-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ask/1/1:A/1:B 2ask/2/1:A/1:B 2ask/2/2:A/2:B 2ask/3/1:A/1:B 2gh0/1/1:D/1:C 2gyr/1/1:A/1:B 2gyr/2/1:C/1:D 2gyr/3/1:E/1:F 2gyz/1/1:A/2:A 6q2s/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 2ask/2/1:A/2:B 2ask/2/1:B/2:A
  • [Back to Home]