2aus/1/1:D/2:D

Sequences
>2aus-a1-m1-cD (length=53) [Search sequence]
RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIG
>2aus-a1-m2-cD (length=53) [Search sequence]
RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIG
Structure information
PDB ID 2aus (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the archaeal box H/ACA sRNP Nop10-Cbf5 complex
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 16456033
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID D D
UniProt accession Q9V0E3 Q9V0E3
Species 29292 (Pyrococcus abyssi) 29292 (Pyrococcus abyssi)
Function annotation BioLiP:2ausD BioLiP:2ausD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2aus-a1-m1-cD_2aus-a1-m2-cD.pdb.gz
Full biological assembly
Download: 2aus-assembly1.cif.gz

[Back to Home]