2aus/5/1:B/3:B

Sequences
>2aus-a5-m1-cB (length=53) [Search sequence]
RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIG
>2aus-a5-m3-cB (length=53) [Search sequence]
RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIG
Structure information
PDB ID 2aus (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the archaeal box H/ACA sRNP Nop10-Cbf5 complex
Assembly ID 5
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 16456033
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession Q9V0E3 Q9V0E3
Species 29292 (Pyrococcus abyssi) 29292 (Pyrococcus abyssi)
Function annotation BioLiP:2ausB BioLiP:2ausB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2aus-a5-m1-cB_2aus-a5-m3-cB.pdb.gz
Full biological assembly
Download: 2aus-assembly5.cif.gz

[Back to Home]