2aze/2/1:C/2:C

Sequences
>2aze-a2-m1-cC (length=44) [Search sequence]
SRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPL
>2aze-a2-m2-cC (length=44) [Search sequence]
SRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPL
Structure information
PDB ID 2aze (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
Assembly ID 2
Resolution 2.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession P06400 P06400
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2aze-a2-m1-cC_2aze-a2-m2-cC.pdb.gz
Full biological assembly
Download: 2aze-assembly2.cif.gz

[Back to Home]