2b2w/1/1:C/1:A

Sequences
>2b2w-a1-m1-cC (length=86) [Search sequence]
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHI
HNTWETEETLKQQNVRGMKKLDNYKK
>2b2w-a1-m1-cA (length=177) [Search sequence]
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHI
HNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQY
QIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Structure information
PDB ID 2b2w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
PubMed citation 16372014
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession O14646 O14646
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2b2wA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2b2w-a1-m1-cC_2b2w-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2b2w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2b2t/1/1:C/1:A 2b2v/1/1:C/1:A
Other dimers with similar sequences but different poses
  • 2b2w/1/1:B/1:A 2b2t/1/1:B/1:A 2b2u/1/1:B/1:A 2b2v/1/1:B/1:A 2b2y/1/1:B/1:A
  • [Back to Home]