2b2w/1/1:C/1:A

Sequences

>2b2w-a1-m1-cC (length=86) [Search sequence]

EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHI HNTWETEETLKQQNVRGMKKLDNYKK

>2b2w-a1-m1-cA (length=177) [Search sequence]

EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHI HNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQY QIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK

Structure information

PDB ID	2b2w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation	16372014

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	O14646	O14646
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2b2wA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2b2w-a1-m1-cC_2b2w-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2b2w-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2b2t/1/1:C/1:A 2b2v/1/1:C/1:A
Other dimers with similar sequences but different poses	2b2w/1/1:B/1:A 2b2t/1/1:B/1:A 2b2u/1/1:B/1:A 2b2v/1/1:B/1:A 2b2y/1/1:B/1:A