2b4r/1/1:P/1:R

Sequences

>2b4r-a1-m1-cP (length=334) [Search sequence]

ATKLGINGFGRIGRLVFRAAFGRKDIEVVAINDPFMDLNHLCYLLKYDSVHGQFPCEVTH
ADGFLLIGEKKVSVFAEKDPSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKVIMS
APPKDDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHAS
TANQLVVDGPSKGGKDWRAGRCALSNIIPASTGAAKAVGKVLPELNGKLTGVAFRVPIGT
VSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTEDEVVSQDFVHDNRSSIFDMKA
GLALNDNFFKLVSWYDNEWGYSNRVLDLAVHITT

>2b4r-a1-m1-cR (length=334) [Search sequence]

Structure information

PDB ID	2b4r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Angstrom Resolution reveals intriguing extra electron density in the active site
Assembly ID	1
Resolution	2.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation	16345073

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	P	R
UniProt accession	Q8T6B1	Q8T6B1
Species	5833 (Plasmodium falciparum)	5833 (Plasmodium falciparum)
Function annotation	BioLiP:2b4rP	BioLiP:2b4rR

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2b4r-a1-m1-cP_2b4r-a1-m1-cR.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2b4r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1ywg/1/1:O/1:Q 1ywg/1/1:P/1:R 2b4r/1/1:O/1:Q 2b4t/1/1:O/1:Q 2b4t/1/1:P/1:R
Other dimers with similar sequences but different poses	2b4r/1/1:Q/1:R 1ywg/1/1:O/1:P 1ywg/1/1:Q/1:R 2b4r/1/1:O/1:P 2b4t/1/1:O/1:P 2b4t/1/1:Q/1:R 2b4r/1/1:O/1:R 1ywg/1/1:O/1:R 1ywg/1/1:P/1:Q 2b4r/1/1:P/1:Q 2b4t/1/1:O/1:R 2b4t/1/1:P/1:Q