2b6o/1/1:A/8:A

Sequences

>2b6o-a1-m1-cA (length=235) [Search sequence]

RSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVGHISG
AHVNPAVTFAFLVGSQMSLLRAICYVVAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPG
VSVGQATIVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMN
PARSFAPAILTRNFTNHWVYWVGPVIGAGLGSLLYDFLLFPRLKSVSERLSILKG

>2b6o-a1-m8-cA (length=235) [Search sequence]

Structure information

PDB ID	2b6o (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Electron crystallographic structure of lens Aquaporin-0 (AQP0) (lens MIP) at 1.9A resolution, in a closed pore state
Assembly ID	1
Resolution	1.9Å
Method of structure determination	ELECTRON CRYSTALLOGRAPHY
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	8
Chain ID	A	A
UniProt accession	Q6J8I9	Q6J8I9
Species	9940 (Ovis aries)	9940 (Ovis aries)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2b6o-a1-m1-cA_2b6o-a1-m8-cA.pdb.gz

Full biological assembly

Download:

2b6o-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1sor/1/1:A/8:A 1sor/1/2:A/7:A 1sor/1/3:A/6:A 1sor/1/4:A/5:A 2b6o/1/2:A/7:A 2b6o/1/3:A/6:A 2b6o/1/4:A/5:A 3m9i/1/1:A/8:A 3m9i/1/2:A/7:A 3m9i/1/3:A/6:A 3m9i/1/4:A/5:A

Other dimers with similar sequences but different poses

1ymg/1/2:A/4:A 1sor/1/1:A/3:A 1sor/1/1:A/4:A 1sor/1/2:A/3:A 1sor/1/2:A/4:A 1sor/1/5:A/7:A 1sor/1/5:A/8:A 1sor/1/6:A/7:A 1sor/1/6:A/8:A 1ymg/1/1:A/3:A 1ymg/1/1:A/4:A 1ymg/1/2:A/3:A 2b6p/1/1:A/3:A 2b6p/1/1:A/4:A 2b6p/1/2:A/3:A 2b6p/1/2:A/4:A 2c32/1/1:A/2:A 2c32/1/1:A/3:A 2c32/1/2:A/4:A 2c32/1/3:A/4:A 3j41/1/1:A/1:B 3j41/1/1:A/1:D 3j41/1/1:B/1:C 3j41/1/1:C/1:D

1sor/1/3:A/8:A 1sor/1/1:A/5:A 1sor/1/2:A/6:A 1sor/1/4:A/7:A