2b9d/2/1:B/3:B

Sequences
>2b9d-a2-m1-cB (length=52) [Search sequence]
MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ
>2b9d-a2-m3-cB (length=52) [Search sequence]
MKQPYAVVASCAYCEKLVRLTVLADHSAIRQLEEMLLRSLNIVCPLCTLQRQ
Structure information
PDB ID 2b9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of HPV E7 CR3 domain
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
PubMed citation 16249186
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession P06465 P06465
Species 10583 (Human papillomavirus type 1a) 10583 (Human papillomavirus type 1a)
Function annotation BioLiP:2b9dB BioLiP:2b9dB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2b9d-a2-m1-cB_2b9d-a2-m3-cB.pdb.gz
Full biological assembly
Download: 2b9d-assembly2.cif.gz
Similar dimers

[Back to Home]