2ba2/1/1:A/1:C

Sequences
>2ba2-a1-m1-cA (length=81) [Search sequence]
GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGK
TLQLILEALQGINKRLDNLES
>2ba2-a1-m1-cC (length=81) [Search sequence]
GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGK
TLQLILEALQGINKRLDNLES
Structure information
PDB ID 2ba2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the DUF16 domain of MPN010 from Mycoplasma pneumoniae
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P75103 P75103
Species 2104 (Mycoplasmoides pneumoniae) 2104 (Mycoplasmoides pneumoniae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ba2-a1-m1-cA_2ba2-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2ba2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ba2/1/1:B/1:A 2ba2/1/1:B/1:C

[Back to Home]