2ba2/1/1:A/1:C

Sequences

>2ba2-a1-m1-cA (length=81) [Search sequence]

GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGK TLQLILEALQGINKRLDNLES

>2ba2-a1-m1-cC (length=81) [Search sequence]

GTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGK TLQLILEALQGINKRLDNLES

Structure information

PDB ID	2ba2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the DUF16 domain of MPN010 from Mycoplasma pneumoniae
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	82
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P75103	P75103
Species	2104 (Mycoplasmoides pneumoniae)	2104 (Mycoplasmoides pneumoniae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ba2-a1-m1-cA_2ba2-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ba2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2ba2/1/1:B/1:A 2ba2/1/1:B/1:C