2ba3/1/1:A/1:B

Sequences
>2ba3-a1-m1-cA (length=51) [Search sequence]
SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN
>2ba3-a1-m1-cB (length=51) [Search sequence]
SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN
Structure information
PDB ID 2ba3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR Structure of NikA N-terminal Fragment
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q52335 Q52335
Species 2492 (Plasmid R64) 2492 (Plasmid R64)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ba3-a1-m1-cA_2ba3-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ba3-assembly1.cif.gz

[Back to Home]