2bd0/1/1:C/1:D

Sequences

>2bd0-a1-m1-cC (length=240) [Search sequence]

KHILLITGAGKGIGRAIALEFARAARHHPDFEPVLVLSSRTAADLEKISLECRAEGALTD
TITADISDMADVRRLTTHIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGT
FFLTQALFALMERQHSGHIFFITSVAATKAFRHSSIYCMSKFGQRGLVETMRLYARKCNV
RITDVQPGAVYTPMWGKVDDEMQALMMMPEDIAAPVVQAYLQPSRTVVEEIILRPTSGDI

>2bd0-a1-m1-cD (length=240) [Search sequence]

Structure information

PDB ID	2bd0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Chlorobium tepidum Sepiapterin Reductase complexed with NADP and Sepiapterin
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0
PubMed citation	16308317

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q8KES3	Q8KES3
Species	194439 (Chlorobaculum tepidum TLS)	194439 (Chlorobaculum tepidum TLS)
Function annotation	BioLiP:2bd0C	BioLiP:2bd0D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2bd0-a1-m1-cC_2bd0-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2bd0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2bd0/1/1:B/1:D 2bd0/1/1:A/1:C