2bd7/1/1:P/1:A

Sequences
>2bd7-a1-m1-cP (length=1) [Search sequence]
I
>2bd7-a1-m1-cA (length=240) [Search sequence]
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEH
NLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTI
LANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGV
RSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Structure information
PDB ID 2bd7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Porcine pancreatic elastase complexed with beta-casomorphin-7 and Arg-Phe at pH 5.0 (50 min soak)
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
PubMed citation 16754679
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID P A
UniProt accession P00772
Species 9823 (Sus scrofa)
Function annotation BioLiP:2bd7A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2bd7-a1-m1-cP_2bd7-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2bd7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2bd2/1/1:P/1:A 2bd4/1/1:P/1:A 2bd5/1/1:P/1:A 2bd8/1/1:P/1:A 2bda/1/1:P/1:A

[Back to Home]