2bdq/1/1:A/1:B

Sequences

>2bdq-a1-m1-cA (length=205) [Search sequence]

ILREFCAENLTDLTRLDKAIISRVELCDNLAVGGTTPSYGVIKEANQYLHEKGISVAVIR
PRGGNFVYNDLELRIEEDILRAVELESDALVLGILTSNNHIDTEAIEQLLPATQGLPLVF
HAFDVIPKSDQKKSIDQLVALGFTRILLHGSSNGEPIIENIKHIKALVEYANNRIEIVGG
GVTAENYQYICQETGVKQAHGTRIT

>2bdq-a1-m1-cB (length=205) [Search sequence]

Structure information

PDB ID	2bdq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Putative Copper Homeostasis Protein CutC from Streptococcus agalactiae, Northeast Strucural Genomics Target SaR15.
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	92
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q8DYB9	Q8DYB9
Species	1311 (Streptococcus agalactiae)	1311 (Streptococcus agalactiae)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2bdq-a1-m1-cA_2bdq-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2bdq-assembly1.cif.gz