2bf9/1/1:A/2:A

Sequences
>2bf9-a1-m1-cA (length=35) [Search sequence]
GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHR
>2bf9-a1-m2-cA (length=35) [Search sequence]
GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHR
Structure information
PDB ID 2bf9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Anisotropic refinement of avian (turkey) pancreatic polypeptide at 0. 99 Angstroms resolution.
Assembly ID 1
Resolution 0.99Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P68249 P68249
Species 9103 (Meleagris gallopavo) 9103 (Meleagris gallopavo)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2bf9-a1-m1-cA_2bf9-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2bf9-assembly1.cif.gz
Similar dimers

[Back to Home]