2bho/1/1:A/2:A

Sequences
>2bho-a1-m1-cA (length=110) [Search sequence]
TTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQQWVQLFSELGADLPTND
NLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQRK
>2bho-a1-m2-cA (length=110) [Search sequence]
TTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQQWVQLFSELGADLPTND
NLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQRK
Structure information
PDB ID 2bho (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Yersinia enterocolitica type III secretion chaperone SycT
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 62
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P0C2V9 P0C2V9
Species 630 (Yersinia enterocolitica) 630 (Yersinia enterocolitica)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2bho-a1-m1-cA_2bho-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2bho-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2bsi/1/1:A/1:B 2bsj/1/1:B/1:A

[Back to Home]