2bnw/1/1:B/1:C

Sequences
>2bnw-a1-m1-cB (length=53) [Search sequence]
MAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
>2bnw-a1-m1-cC (length=53) [Search sequence]
MAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Structure information
PDB ID 2bnw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis for cooperative binding of Ribbon-Helix-Helix Omega repressor to direct DNA heptad repeats
Assembly ID 1
Resolution 2.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 16528102
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q57468 Q57468
Species 1314 (Streptococcus pyogenes) 1314 (Streptococcus pyogenes)
Function annotation BioLiP:2bnwB BioLiP:2bnwC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2bnw-a1-m1-cB_2bnw-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2bnw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2bnz/1/1:A/1:C 2cax/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 2cax/1/1:B/1:A 1irq/1/1:A/1:B 2bnw/1/1:A/1:B 2bnw/1/1:D/1:C 2bnz/1/1:A/1:B 2bnz/1/1:D/1:C 2cax/1/1:D/1:C
  • [Back to Home]