2boy/4/1:H/1:D

Sequences

>2boy-a4-m1-cH (length=248) [Search sequence]

STDRTGNIVGKMIAAINAVIKDEKVSYSEYKASTGWLISVGEKNEWPLFLDVFFEHAIES
VAAESNRGSQSSIQGPYFIPGAPELSIPYTMPMRDDESGDTLIFRGEVVDQEGAPLADVL
LDMWQADAAGEYSFINPTLPDYLFRGKIRTDENGRFTLRTIVPAPYEIPKNGPTGALLAA
AGWHAWRPAHLHWIIAKEGYESLTTQLYFENGQWTGSDVANAVKPELLLSLDKIPHFETS
YKFTLGKV

>2boy-a4-m1-cD (length=251) [Search sequence]

Structure information

PDB ID	2boy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 3-ChloroCatechol 1,2-Dioxygenase from Rhodococcus Opacus 1CP
Assembly ID	4
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	138
Sequence identity between the two chains	1.0
PubMed citation	16793061

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	D
UniProt accession	Q8G9L3	Q8G9L3
Species	37919 (Rhodococcus opacus)	37919 (Rhodococcus opacus)
Function annotation	BioLiP:2boyH	BioLiP:2boyD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2boy-a4-m1-cH_2boy-a4-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2boy-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2boy/1/2:E/1:A 2boy/2/1:F/3:B 2boy/3/1:G/4:C