2bti/1/1:B/1:A

Sequences
>2bti-a1-m1-cB (length=55) [Search sequence]
GSLILTRRVGETLIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEK
>2bti-a1-m1-cA (length=56) [Search sequence]
SLILTRRVGETLIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQ
Structure information
PDB ID 2bti (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure-function studies of the RmsA CsrA post-transcriptional global regulator protein family reveals a class of RNA-binding structure
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 130
Sequence identity between the two chains 0.982
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A1JK11 A1JK11
Species 630 (Yersinia enterocolitica) 630 (Yersinia enterocolitica)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2bti-a1-m1-cB_2bti-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2bti-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vpz/1/1:B/1:A 7yr6/1/1:B/1:C 7yr7/1/1:B/1:D 7yr7/1/1:C/1:F 7yr7/1/1:E/1:G

[Back to Home]