2bv4/1/1:B/2:B

Sequences
>2bv4-a1-m1-cB (length=113) [Search sequence]
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSG
NVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
>2bv4-a1-m2-cB (length=113) [Search sequence]
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSG
NVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
Structure information
PDB ID 2bv4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.0A Structure of Chromobacterium Violaceum Lectin in Complex with alpha-methyl-mannoside
Assembly ID 1
Resolution 1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
PubMed citation 16768446
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q7NX84 Q7NX84
Species 536 (Chromobacterium violaceum) 536 (Chromobacterium violaceum)
Function annotation BioLiP:2bv4B BioLiP:2bv4B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2bv4-a1-m1-cB_2bv4-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2bv4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2boi/1/1:A/2:A 2boi/1/1:B/2:B 2bv4/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 2bv4/1/2:A/2:B 2boi/1/1:A/1:B 2boi/1/2:A/2:B 2bv4/1/1:A/1:B
  • 2bv4/1/1:A/2:B 2boi/1/1:A/2:B 2boi/1/1:B/2:A 2bv4/1/1:B/2:A
    		•

    [Back to Home]