2bwe/2/1:P/1:O

Sequences
>2bwe-a2-m1-cP (length=44) [Search sequence]
DPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLN
>2bwe-a2-m1-cO (length=46) [Search sequence]
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Structure information
PDB ID 2bwe (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the complex between the UBA and UBL domains of Dsk2
Assembly ID 2
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID P O
UniProt accession P48510 P48510
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2bwe-a2-m1-cP_2bwe-a2-m1-cO.pdb.gz
Full biological assembly
Download: 2bwe-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2bwe/1/1:A/1:B 2bwe/1/1:E/1:D 2bwe/1/1:F/1:E 2bwe/1/1:F/1:G 2bwe/1/1:H/1:G 2bwe/1/1:H/1:I 2bwe/2/1:N/1:O 2bwe/2/1:P/1:Q 2bwe/2/1:R/1:Q 2bwe/3/1:J/1:K 2bwe/3/1:L/1:K 2bwe/3/1:M/1:L

[Back to Home]