2bzb/1/1:A/1:B

Sequences
>2bzb-a1-m1-cA (length=62) [Search sequence]
MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHH
HH
>2bzb-a1-m1-cB (length=62) [Search sequence]
MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHH
HH
Structure information
PDB ID 2bzb (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR Solution Structure of a protein aspartic acid phosphate phosphatase from Bacillus Anthracis
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession A0A4Y1VZT9 A0A4Y1VZT9
Species 198094 (Bacillus anthracis str. Ames) 198094 (Bacillus anthracis str. Ames)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2bzb-a1-m1-cA_2bzb-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2bzb-assembly1.cif.gz

[Back to Home]