2bzb/1/1:A/1:B

Sequences

>2bzb-a1-m1-cA (length=62) [Search sequence]

MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHH HH

>2bzb-a1-m1-cB (length=62) [Search sequence]

MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHH HH

Structure information

PDB ID	2bzb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NMR Solution Structure of a protein aspartic acid phosphate phosphatase from Bacillus Anthracis
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	60
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A0A4Y1VZT9	A0A4Y1VZT9
Species	198094 (Bacillus anthracis str. Ames)	198094 (Bacillus anthracis str. Ames)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2bzb-a1-m1-cA_2bzb-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2bzb-assembly1.cif.gz