2c41/1/1:J/1:I

Sequences
>2c41-a1-m1-cJ (length=153) [Search sequence]
TLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAER
SLMLDGQPVADPADYLKVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGD
IGTADLYTRLVQTHQKHRWFLKEFLAKGDGLVS
>2c41-a1-m1-cI (length=154) [Search sequence]
TTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
RSLMLDGQPVADPADYLKVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAG
DIGTADLYTRLVQTHQKHRWFLKEFLAKGDGLVS
Structure information
PDB ID 2c41 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of Dps from Thermosynechococcus elongatus
Assembly ID 1
Resolution 1.81Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID J I
UniProt accession Q8DG54 Q8DG54
Species 197221 (Thermosynechococcus vestitus BP-1) 197221 (Thermosynechococcus vestitus BP-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2c41-a1-m1-cJ_2c41-a1-m1-cI.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2c41-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2c41/1/1:B/1:A 2c41/1/1:D/1:C 2c41/1/1:E/1:F 2c41/1/1:G/1:H 2c41/1/1:K/1:L
Other dimers with similar sequences but different poses
  • 2c41/1/1:K/1:G 2c41/1/1:A/1:F 2c41/1/1:B/1:I 2c41/1/1:B/1:L 2c41/1/1:D/1:A 2c41/1/1:D/1:F 2c41/1/1:E/1:H 2c41/1/1:G/1:C 2c41/1/1:I/1:L 2c41/1/1:J/1:E 2c41/1/1:J/1:H 2c41/1/1:K/1:C
  • 2c41/1/1:K/1:D 2c41/1/1:B/1:D 2c41/1/1:E/1:A 2c41/1/1:E/1:I 2c41/1/1:F/1:C 2c41/1/1:G/1:L 2c41/1/1:H/1:C 2c41/1/1:H/1:F 2c41/1/1:I/1:A 2c41/1/1:J/1:G 2c41/1/1:J/1:L 2c41/1/1:K/1:B
  • [Back to Home]