2c5r/1/1:A/1:E

Sequences

>2c5r-a1-m1-cA (length=63) [Search sequence]

NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYR GSL

>2c5r-a1-m1-cE (length=63) [Search sequence]

NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYR GSL

Structure information

PDB ID	2c5r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded DNA
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	E
UniProt accession	P16517	P16517
Species	10756 (Salasvirus phi29)	10756 (Salasvirus phi29)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2c5r-a1-m1-cA_2c5r-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2c5r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2c5r/1/1:E/1:F 1zae/1/1:A/1:B 2bnk/1/1:A/1:B 2c5r/1/1:A/1:B 2c5r/1/1:C/1:D