2c5r/1/1:E/1:F

Sequences
>2c5r-a1-m1-cE (length=63) [Search sequence]
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYR
GSL
>2c5r-a1-m1-cF (length=63) [Search sequence]
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYR
GSL
Structure information
PDB ID 2c5r (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of phage phi29 replication organizer protein p16.7 in complex with double stranded DNA
Assembly ID 1
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 67
Sequence identity between the two chains 1.0
PubMed citation 16275651
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession P16517 P16517
Species 10756 (Salasvirus phi29) 10756 (Salasvirus phi29)
Function annotation BioLiP:2c5rF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2c5r-a1-m1-cE_2c5r-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2c5r-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zae/1/1:A/1:B 2bnk/1/1:A/1:B 2c5r/1/1:A/1:B 2c5r/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2c5r/1/1:A/1:E 2c5r/1/1:B/1:C
  • [Back to Home]