2cgz/1/5:A/6:A

Sequences
>2cgz-a1-m5-cA (length=100) [Search sequence]
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQ
NLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
>2cgz-a1-m6-cA (length=100) [Search sequence]
RVQSGKINCGDDAGWAKVPSDDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQ
NLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
Structure information
PDB ID 2cgz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Helix Pomatia agglutinin with Tn antigen
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 6
Chain ID A A
UniProt accession Q2F1K8 Q2F1K8
Species 6536 (Helix pomatia) 6536 (Helix pomatia)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2cgz-a1-m5-cA_2cgz-a1-m6-cA.pdb.gz
Full biological assembly
Download: 2cgz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ccv/1/1:A/2:A 2ccv/1/1:A/3:A 2ccv/1/2:A/3:A 2ccv/1/4:A/5:A 2ccv/1/4:A/6:A 2ccv/1/5:A/6:A 2ce6/1/1:A/2:A 2ce6/1/1:A/3:A 2ce6/1/2:A/3:A 2ce6/1/4:A/5:A 2ce6/1/4:A/6:A 2ce6/1/5:A/6:A 2cgy/1/1:A/3:A 2cgy/1/1:A/6:A 2cgy/1/2:A/4:A 2cgy/1/2:A/5:A 2cgy/1/3:A/6:A 2cgy/1/4:A/5:A 2cgz/1/1:A/2:A 2cgz/1/1:A/3:A 2cgz/1/2:A/3:A 2cgz/1/4:A/5:A 2cgz/1/4:A/6:A

[Back to Home]