2chp/1/3:C/3:D

Sequences
>2chp-a1-m3-cC (length=145) [Search sequence]
NQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAERL
LAIGGQPVATVKEYTEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENQDN
ATADLFVGLIEEVEKQVWMLSSYLG
>2chp-a1-m3-cD (length=145) [Search sequence]
NQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAERL
LAIGGQPVATVKEYTEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENQDN
ATADLFVGLIEEVEKQVWMLSSYLG
Structure information
PDB ID 2chp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the dodecameric ferritin MrgA from B. subtilis 168
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID C D
UniProt accession P37960 P37960
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2chp-a1-m3-cC_2chp-a1-m3-cD.pdb.gz
Full biological assembly
Download: 2chp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2chp/1/1:B/1:A 2chp/1/1:C/1:D 2chp/1/2:B/2:A 2chp/1/2:C/2:D 2chp/1/3:B/3:A
Other dimers with similar sequences but different poses
  • 2chp/1/2:C/3:D 2chp/1/1:B/2:B 2chp/1/1:B/3:B 2chp/1/1:C/2:A 2chp/1/1:C/2:D 2chp/1/1:D/1:A 2chp/1/1:D/3:C 2chp/1/2:B/3:B 2chp/1/2:C/3:A 2chp/1/2:D/2:A 2chp/1/3:C/1:A 2chp/1/3:D/3:A
  • 2chp/1/2:D/3:D 2chp/1/1:B/3:A 2chp/1/1:C/1:A 2chp/1/1:C/2:B 2chp/1/1:D/2:D 2chp/1/1:D/3:D 2chp/1/2:B/1:A 2chp/1/2:C/2:A 2chp/1/2:C/3:B 2chp/1/3:B/2:A 2chp/1/3:C/1:B 2chp/1/3:C/3:A
  • [Back to Home]