2clb/2/5:P/4:O

Sequences
>2clb-a2-m5-cP (length=164) [Search sequence]
EPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRHLTGEGEGLKEIAEDARL
EDRLHFELTQRIYELGGGLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAIR
TWKEVCDTYGKDPRTYDLAQRILQEEIEHEAWFLELLYGRPSGH
>2clb-a2-m4-cO (length=165) [Search sequence]
QEPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRHLTGEGEGLKEIAEDAR
LEDRLHFELTQRIYELGGGLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAI
RTWKEVCDTYGKDPRTYDLAQRILQEEIEHEAWFLELLYGRPSGH
Structure information
PDB ID 2clb (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of the DPS-like protein from Sulfolobus solfataricus reveals a bacterioferritin-like di-metal binding site within a Dps- like dodecameric assembly
Assembly ID 2
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
PubMed citation 16953567
Chain information
Chain 1 Chain 2
Model ID 5 4
Chain ID P O
UniProt accession P95855 P95855
Species 273057 (Saccharolobus solfataricus P2) 273057 (Saccharolobus solfataricus P2)
Function annotation BioLiP:2clbP BioLiP:2clbO
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2clb-a2-m5-cP_2clb-a2-m4-cO.pdb.gz
Full biological assembly
Download: 2clb-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2clb/1/1:B/1:A 2clb/1/1:D/3:C 2clb/1/2:B/2:A 2clb/1/2:D/1:C 2clb/1/3:B/3:A 2clb/1/3:D/2:C 2clb/2/1:N/1:M 2clb/2/1:P/5:O 2clb/2/4:N/4:M 2clb/2/4:P/1:O 2clb/2/5:N/5:M
Other dimers with similar sequences but different poses
  • 2clb/2/4:P/5:P 2clb/1/1:A/1:C 2clb/1/1:B/3:A 2clb/1/1:B/3:C 2clb/1/1:D/2:D 2clb/1/1:D/3:D 2clb/1/2:A/2:C 2clb/1/2:B/1:A 2clb/1/2:B/1:C 2clb/1/2:D/3:D 2clb/1/3:A/3:C 2clb/1/3:B/2:A 2clb/1/3:B/2:C 2clb/2/1:M/1:O 2clb/2/1:N/5:M 2clb/2/1:N/5:O 2clb/2/1:P/4:P 2clb/2/1:P/5:P 2clb/2/4:M/4:O 2clb/2/4:N/1:M 2clb/2/4:N/1:O 2clb/2/5:M/5:O 2clb/2/5:N/4:M 2clb/2/5:N/4:O
  • 2clb/2/5:P/5:O 2clb/1/1:A/2:A 2clb/1/1:A/3:A 2clb/1/1:B/1:C 2clb/1/1:B/1:D 2clb/1/1:D/1:C 2clb/1/2:A/3:A 2clb/1/2:B/2:C 2clb/1/2:B/2:D 2clb/1/2:D/2:C 2clb/1/3:B/3:C 2clb/1/3:B/3:D 2clb/1/3:D/3:C 2clb/2/1:M/4:M 2clb/2/1:M/5:M 2clb/2/1:N/1:O 2clb/2/1:N/1:P 2clb/2/1:P/1:O 2clb/2/4:M/5:M 2clb/2/4:N/4:O 2clb/2/4:N/4:P 2clb/2/4:P/4:O 2clb/2/5:N/5:O 2clb/2/5:N/5:P
  • [Back to Home]