2cu6/2/4:A/4:B

Sequences
>2cu6-a2-m4-cA (length=90) [Search sequence]
PLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRTLTTPGCPLHDSLGEAVRQ
ALSRLPGVEEVEVEVTFEPPWTLARLSEKA
>2cu6-a2-m4-cB (length=90) [Search sequence]
PLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRTLTTPGCPLHDSLGEAVRQ
ALSRLPGVEEVEVEVTFEPPWTLARLSEKA
Structure information
PDB ID 2cu6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID A B
UniProt accession Q53W28 Q53W28
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2cu6-a2-m4-cA_2cu6-a2-m4-cB.pdb.gz
Full biological assembly
Download: 2cu6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2cu6/1/1:A/1:B 2cu6/2/1:A/1:B 2cu6/2/1:A/4:B 2cu6/2/1:B/4:A 2cu6/2/2:A/2:B 2cu6/2/2:A/3:B 2cu6/2/2:B/3:A 2cu6/2/3:A/3:B 3cq2/1/1:A/1:B 3cq2/1/1:A/1:D 3cq2/1/1:C/1:B 3cq2/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2cu6/2/2:A/4:B 2cu6/2/1:A/3:B 2cu6/2/1:B/3:A 2cu6/2/2:B/4:A 3cq1/1/1:A/2:A 3cq3/1/1:A/2:A 3cq3/2/1:B/1:C 3cq3/3/1:D/1:E
    		•

    [Back to Home]