2cvz/1/1:A/1:D

Sequences

>2cvz-a1-m1-cA (length=283) [Search sequence]

EKVAFIGLGAGYPAGHLARRFPTLVWNRTFEKALRHQEEFGSEAVPLERVAEARVIFTCL
PTTREVYEVAEALYPYLREGTYWVDATSGEPEASRRLAERLREKGVTYLDAPVSGGTSGA
EAGTLTVLGGPEEAVERVRPFLAYAKKVVHVGPVGAGHAVKAINNALLAVNLWAAGEGLL
ALVKQGVSAEKALEVINASSGRSNATENLIPQRVLTRAFPKTFALGLLVKDLGIAGVLDG
EKAPSPLLRLAREVYEAKRELGPDADHVEALRLLERWGGVEIR

>2cvz-a1-m1-cD (length=283) [Search sequence]

Structure information

PDB ID	2cvz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0
PubMed citation	16126223

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q5SLQ6	Q5SLQ6
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:2cvzA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2cvz-a1-m1-cA_2cvz-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2cvz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1wp4/1/1:A/1:C 1wp4/1/1:B/1:D 2cvz/1/1:B/1:C
Other dimers with similar sequences but different poses	1wp4/1/1:C/1:D 1wp4/1/1:A/1:B 2cvz/1/1:A/1:B 2cvz/1/1:C/1:D 1wp4/1/1:A/1:D 1wp4/1/1:B/1:C 2cvz/1/1:A/1:C 2cvz/1/1:B/1:D