2cz4/2/2:C/2:B

Sequences

>2cz4-a2-m2-cC (length=91) [Search sequence]

DLVPLKLVTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSEGQNIRLETIVSEEVALR ILQRLQEEYFPHYAVIAYVENVWVVRGEKYV

>2cz4-a2-m2-cB (length=92) [Search sequence]

DLVPLKLVTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGDWEGQNIRLETIVSEEVAL RILQRLQEEYFPHYAVIAYVENVWVVRGEKYV

Structure information

PDB ID	2cz4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
Assembly ID	2
Resolution	1.93Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	B
UniProt accession	Q5SKX7	Q5SKX7
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2cz4-a2-m2-cC_2cz4-a2-m2-cB.pdb.gz

Full biological assembly Download: 2cz4-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2cz4/1/1:B/1:A 2cz4/1/1:C/1:A 2cz4/1/1:C/1:B 2cz4/2/1:B/1:A 2cz4/2/1:C/1:A 2cz4/2/1:C/1:B 2cz4/2/2:B/2:A 2cz4/2/2:C/2:A
Other dimers with similar sequences but different poses	2cz4/2/2:C/1:B 2cz4/2/1:A/2:A 2cz4/2/1:C/2:B