2d0n/1/1:C/1:A

Sequences

>2d0n-a1-m1-cC (length=56) [Search sequence]

PWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM

>2d0n-a1-m1-cA (length=59) [Search sequence]

GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR

Structure information

PDB ID	2d0n (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Assembly ID	1
Resolution	1.57Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation	17010654

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	O89100	O89100
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:2d0nC	BioLiP:2d0nA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2d0n-a1-m1-cC_2d0n-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2d0n-assembly1.cif.gz