2d1x/2/1:D/1:C

Sequences

>2d1x-a2-m1-cD (length=59) [Search sequence]

DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

>2d1x-a2-m1-cC (length=66) [Search sequence]

GPLGSENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPAN YVELRQ

Structure information

PDB ID	2d1x (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0
PubMed citation	16636290

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q14247	Q14247
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2d1xD	BioLiP:2d1xC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2d1x-a2-m1-cD_2d1x-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2d1x-assembly2.cif.gz

Similar dimers