2d45/1/1:D/1:C

Sequences
>2d45-a1-m1-cD (length=112) [Search sequence]
EISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQY
YSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
>2d45-a1-m1-cC (length=114) [Search sequence]
TYEISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIF
QYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
Structure information
PDB ID 2d45 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the MecI-mecA repressor-operator complex
Assembly ID 1
Resolution 3.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
PubMed citation 16582476
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P68261 P68261
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
Function annotation BioLiP:2d45D BioLiP:2d45C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2d45-a1-m1-cD_2d45-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2d45-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1okr/1/1:A/1:B 1sax/1/1:A/1:B 1sd6/1/1:B/1:A 1sd7/1/1:B/1:A 2d45/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 2d45/1/1:D/1:A 2d45/1/1:C/1:B
  • [Back to Home]