2d7h/1/1:A/1:C

Sequences
>2d7h-a1-m1-cA (length=102) [Search sequence]
AHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAV
VEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
>2d7h-a1-m1-cC (length=105) [Search sequence]
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNEL
KAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Structure information
PDB ID 2d7h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the ccc complex of the N-terminal domain of PriA
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
PubMed citation 17464287
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P17888 P17888
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
Function annotation BioLiP:2d7hA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2d7h-a1-m1-cA_2d7h-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2d7h-assembly1.cif.gz

[Back to Home]