2d9s/1/1:A/1:B

Sequences

>2d9s-a1-m1-cA (length=53) [Search sequence]

GSSGSSGQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFSGPSSG

>2d9s-a1-m1-cB (length=53) [Search sequence]

GSSGSSGQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFSGPSSG

Structure information

PDB ID	2d9s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Solution structure of RSGI RUH-049, a UBA domain from mouse cDNA
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P22682	P22682
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2d9s-a1-m1-cA_2d9s-a1-m1-cB.pdb.gz

Full biological assembly Download: 2d9s-assembly1.cif.gz