2dcn/2/1:J/1:L

Sequences

>2dcn-a2-m1-cJ (length=308) [Search sequence]

AKLITLGEILIEFNALSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEF
GYNAIEWLRGQGVDVSHMKIDPSAPTGIFFIQRHYPVPLKSESIYYRKGSAGSKLSPEDV
DEEYVKSADLVHSSGITLAISSTAKEAVYKAFEIASNRSFDTNIRLKLWSAEEAKREILK
LLSKFHLKFLITDTDDSKIILGESDPDKAAKAFSDYAEIIVMKLGPKGAIVYYDGKKYYS
SGYQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNVMIRGDQENLPTTKD
IETFLREM

>2dcn-a2-m1-cL (length=308) [Search sequence]

Structure information

PDB ID	2dcn (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 2-keto-3-deoxygluconate kinase from Sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
Assembly ID	2
Resolution	2.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	J	L
UniProt accession	Q96XN9	Q96XN9
Species	273063 (Sulfurisphaera tokodaii str. 7)	273063 (Sulfurisphaera tokodaii str. 7)
Function annotation	BioLiP:2dcnJ	BioLiP:2dcnL

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2dcn-a2-m1-cJ_2dcn-a2-m1-cL.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2dcn-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1wye/1/1:A/1:C 1wye/1/1:A/1:E 1wye/1/1:B/1:D 1wye/1/1:B/1:F 1wye/1/1:C/1:E 1wye/1/1:D/1:F 2dcn/1/1:A/1:C 2dcn/1/1:A/1:E 2dcn/1/1:B/1:D 2dcn/1/1:B/1:F 2dcn/1/1:C/1:E 2dcn/1/1:D/1:F 2dcn/2/1:G/1:I 2dcn/2/1:G/1:K 2dcn/2/1:H/1:J 2dcn/2/1:H/1:L 2dcn/2/1:I/1:K
Other dimers with similar sequences but different poses	2dcn/2/1:K/1:L 1wye/1/1:A/1:B 1wye/1/1:C/1:D 1wye/1/1:E/1:F 2dcn/1/1:A/1:B 2dcn/1/1:C/1:D 2dcn/1/1:E/1:F 2dcn/2/1:G/1:H 2dcn/2/1:I/1:J 2dcn/2/1:I/1:L 1wye/1/1:A/1:F 1wye/1/1:B/1:C 1wye/1/1:D/1:E 2dcn/1/1:A/1:D 2dcn/1/1:B/1:E 2dcn/1/1:C/1:F 2dcn/2/1:G/1:J 2dcn/2/1:H/1:K