2dgb/1/1:A/1:D

Sequences
>2dgb-a1-m1-cA (length=81) [Search sequence]
PRYQATLLIELKKGILDPQGRAVEGVLKDLGHPVEEVRVGKVLEIVFPAENLLEAEEKAK
AGALLANPVEVYALEALKELP
>2dgb-a1-m1-cD (length=81) [Search sequence]
PRYQATLLIELKKGILDPQGRAVEGVLKDLGHPVEEVRVGKVLEIVFPAENLLEAEEKAK
AGALLANPVEVYALEALKELP
Structure information
PDB ID 2dgb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Thermus thermophilus PurS in the P21 Form
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 86
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession Q72II0 Q72II0
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2dgb-a1-m1-cA_2dgb-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2dgb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2cuw/2/1:A/2:A 2dgb/2/1:B/1:C

[Back to Home]