2dge/2/2:D/2:B

Sequences
>2dge-a2-m2-cD (length=100) [Search sequence]
QTLDIQRGATLFNRACIGCHDTGGNIIQPGATLFTKDLERNGVDTEEEIYRVTYFGKGRM
PGFGEKCTPRGQCTFGPRLQDEEIKLLAEFVKFQADQGWP
>2dge-a2-m2-cB (length=102) [Search sequence]
QTLDIQRGATLFNRACIGCHDTGGNIIQPGATLFTKDLERNGVDTEEEIYRVTYFGKGRM
PGFGEKCTPRGQCTFGPRLQDEEIKLLAEFVKFQADQGWPTV
Structure information
PDB ID 2dge (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of oxidized cytochrome C6A from Arabidopsis thaliana
Assembly ID 2
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 16777100
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID D B
UniProt accession Q93VA3 Q93VA3
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:2dgeD BioLiP:2dgeB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2dge-a2-m2-cD_2dge-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2dge-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2dge/1/1:A/1:C 2dge/1/1:D/1:B 2dge/2/1:A/1:C
Other dimers with similar sequences but different poses
  • 2dge/1/1:D/1:A 2dge/1/1:B/1:C
  • [Back to Home]