2djw/1/1:F/1:G

Sequences
>2djw-a1-m1-cF (length=80) [Search sequence]
MITAFVLIRPRGNRVQALGEAIAELPQVAEVYSVTGPYDLVALVRLKDVEELDDVVTQGI
LSLEGVERTETLLAFRAYPR
>2djw-a1-m1-cG (length=80) [Search sequence]
MITAFVLIRPRGNRVQALGEAIAELPQVAEVYSVTGPYDLVALVRLKDVEELDDVVTQGI
LSLEGVERTETLLAFRAYPR
Structure information
PDB ID 2djw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of TTHA0845 from Thermus thermophilus HB8
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 16946463
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F G
UniProt accession Q5SK07 Q5SK07
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
Function annotation BioLiP:2djwG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2djw-a1-m1-cF_2djw-a1-m1-cG.pdb.gz
Full biological assembly
Download: 2djw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2djw/1/1:A/1:B 2djw/1/1:A/1:E 2djw/1/1:B/1:C 2djw/1/1:C/1:D 2djw/1/1:D/1:E 2djw/1/1:F/1:J 2djw/1/1:H/1:G 2djw/1/1:H/1:I 2djw/1/1:I/1:J
Other dimers with similar sequences but different poses
  • 2djw/1/1:H/1:C 2djw/1/1:A/1:F 2djw/1/1:B/1:G 2djw/1/1:D/1:I 2djw/1/1:E/1:J
  • 2djw/1/1:D/1:J 2djw/1/1:A/1:G 2djw/1/1:C/1:I 2djw/1/1:E/1:F 2djw/1/1:H/1:B
  • [Back to Home]