2dkg/1/1:A/1:B

Sequences

>2dkg-a1-m1-cA (length=235) [Search sequence]

MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGL
WLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGK
GDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILN
LVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL

>2dkg-a1-m1-cB (length=235) [Search sequence]

Structure information

PDB ID	2dkg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotinyl-5'-AMP, Pyrophosphate and Mg(2+)
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	69
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O57883	O57883
Species	70601 (Pyrococcus horikoshii OT3)	70601 (Pyrococcus horikoshii OT3)
Function annotation	BioLiP:2dkgA	BioLiP:2dkgB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2dkg-a1-m1-cA_2dkg-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2dkg-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1wnl/1/1:A/1:B 1wpy/1/1:A/1:B 1wq7/1/1:B/1:A 1wqw/1/1:A/1:B 1x01/1/1:A/1:B 2deq/1/1:B/1:A 2djz/1/1:B/1:A 2dth/1/1:A/1:B 2dti/1/1:A/1:B 2dto/1/1:A/1:B 2dve/1/1:A/1:B 2dxt/1/1:A/1:B 2dxu/1/1:B/1:A 2dz9/1/1:A/1:B 2dzc/1/1:A/1:B 2e1h/1/1:A/1:B 2e41/1/1:B/1:A 2e64/1/1:A/1:B 2e65/1/1:B/1:A 2fyk/1/1:A/1:B 2hni/1/1:A/1:B 2zgw/1/1:B/1:A