2ds5/1/1:A/1:B

Sequences
>2ds5-a1-m1-cA (length=43) [Search sequence]
GKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI
>2ds5-a1-m1-cB (length=44) [Search sequence]
SGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI
Structure information
PDB ID 2ds5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the ZBD in the orthorhomibic crystal from
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
PubMed citation 17258768
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0A6H1 P0A6H1
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:2ds5A BioLiP:2ds5B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ds5-a1-m1-cA_2ds5-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2ds5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ds6/1/1:B/1:A 2ds7/1/1:A/2:A 2ds8/1/1:B/1:A

[Back to Home]