2dsy/1/1:C/1:D

Sequences
>2dsy-a1-m1-cC (length=74) [Search sequence]
GTLTRYLEEAARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLL
SRGETPPPLGEVRI
>2dsy-a1-m1-cD (length=79) [Search sequence]
GGTLTRYLEEAARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFL
LSRGETPPPLGEVRIELPH
Structure information
PDB ID 2dsy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of TTHA0281 from thermus thermophilus HB8
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q5SLL2 Q5SLL2
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2dsy-a1-m1-cC_2dsy-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2dsy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2dsy/1/1:A/1:D 2dsy/1/1:C/1:B
  • [Back to Home]