2dwn/3/2:B/1:A

Sequences

>2dwn-a3-m2-cB (length=104) [Search sequence]

MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNEL KAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL

>2dwn-a3-m1-cA (length=105) [Search sequence]

MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNEL KAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR

Structure information

PDB ID	2dwn (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the PriA protein complexed with oligonucleotides
Assembly ID	3
Resolution	3.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0
PubMed citation	17464287

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	B	A
UniProt accession	P17888	P17888
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:2dwnA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2dwn-a3-m2-cB_2dwn-a3-m1-cA.pdb.gz

Full biological assembly Download: 2dwn-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2d7e/3/1:B/2:A 2d7e/3/2:B/1:A 2d7e/4/1:C/3:C 2d7e/4/1:D/3:D 2dwn/3/1:B/2:A 2dwn/4/1:C/3:C 2dwn/4/1:D/3:D
Other dimers with similar sequences but different poses	2dwn/4/3:D/3:C 2d7e/1/1:B/1:A 2d7e/2/1:D/1:C 2d7e/3/1:B/1:A 2d7e/3/2:B/2:A 2d7e/4/1:D/1:C 2d7e/4/3:D/3:C 2d7g/1/1:A/1:B 2d7g/2/1:D/1:C 2d7h/1/1:D/1:C 2dwl/1/1:B/1:A 2dwl/2/1:D/1:C 2dwm/1/1:B/1:A 2dwm/2/1:D/1:C 2dwn/1/1:B/1:A 2dwn/2/1:D/1:C 2dwn/3/1:B/1:A 2dwn/3/2:B/2:A 2dwn/4/1:D/1:C