2dwn/4/3:D/3:C

Sequences
>2dwn-a4-m3-cD (length=103) [Search sequence]
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELK
AVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL
>2dwn-a4-m3-cC (length=105) [Search sequence]
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNEL
KAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Structure information
PDB ID 2dwn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PriA protein complexed with oligonucleotides
Assembly ID 4
Resolution 3.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 163
Sequence identity between the two chains 1.0
PubMed citation 17464287
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID D C
UniProt accession P17888 P17888
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
Function annotation BioLiP:2dwnC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2dwn-a4-m3-cD_2dwn-a4-m3-cC.pdb.gz
Full biological assembly
Download: 2dwn-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2d7e/1/1:B/1:A 2d7e/2/1:D/1:C 2d7e/3/1:B/1:A 2d7e/3/2:B/2:A 2d7e/4/1:D/1:C 2d7e/4/3:D/3:C 2d7g/1/1:A/1:B 2d7g/2/1:D/1:C 2d7h/1/1:D/1:C 2dwl/1/1:B/1:A 2dwl/2/1:D/1:C 2dwm/1/1:B/1:A 2dwm/2/1:D/1:C 2dwn/1/1:B/1:A 2dwn/2/1:D/1:C 2dwn/3/1:B/1:A 2dwn/3/2:B/2:A 2dwn/4/1:D/1:C
Other dimers with similar sequences but different poses
  • 2dwn/3/2:B/1:A 2d7e/3/1:B/2:A 2d7e/3/2:B/1:A 2d7e/4/1:C/3:C 2d7e/4/1:D/3:D 2dwn/3/1:B/2:A 2dwn/4/1:C/3:C 2dwn/4/1:D/3:D
    		•

    [Back to Home]