2dwv/1/1:A/1:B

Sequences
>2dwv-a1-m1-cA (length=49) [Search sequence]
GSSGSSGPLEREGLPPGWERVESSEFGTYYVDHTNKRAQYRHPSGPSSG
>2dwv-a1-m1-cB (length=49) [Search sequence]
GSSGSSGPLEREGLPPGWERVESSEFGTYYVDHTNKRAQYRHPSGPSSG
Structure information
PDB ID 2dwv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the second WW domain from mouse salvador homolog 1 protein (mWW45)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8VEB2 Q8VEB2
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2dwv-a1-m1-cA_2dwv-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2dwv-assembly1.cif.gz

[Back to Home]