2dxf/1/3:A/3:B

Sequences
>2dxf-a1-m3-cA (length=153) [Search sequence]
ETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFK
ALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHA
SDSKESAEREISLFFKPEELFEYPRAADWFYKK
>2dxf-a1-m3-cB (length=154) [Search sequence]
SETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFF
KALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIH
ASDSKESAEREISLFFKPEELFEYPRAADWFYKK
Structure information
PDB ID 2dxf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of nucleoside diphosphate kinase in complex with GTP analog
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 86
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession O58429 O58429
Species 70601 (Pyrococcus horikoshii OT3) 70601 (Pyrococcus horikoshii OT3)
Function annotation BioLiP:2dxfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2dxf-a1-m3-cA_2dxf-a1-m3-cB.pdb.gz
Full biological assembly
Download: 2dxf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2cwk/1/1:B/1:A 2cwk/2/1:B/1:A 2cwk/2/2:B/2:A 2cwk/2/3:B/3:A 2dxd/1/1:A/1:B 2dxd/1/2:A/2:B 2dxd/1/3:A/3:B 2dxd/2/1:A/1:B 2dxd/2/2:A/2:B 2dxd/2/3:A/3:B 2dxd/2/4:A/4:B 2dxd/2/5:A/5:B 2dxd/2/6:A/6:B 2dxe/1/1:A/1:B 2dxe/1/2:A/2:B 2dxe/1/3:A/3:B 2dxf/1/1:A/1:B 2dxf/1/2:A/2:B 2dy9/1/1:A/1:B 2dy9/1/2:A/2:B 2dy9/1/3:A/3:B 2dya/1/1:A/1:B 2dya/1/2:A/2:B 2dya/1/3:A/3:B
Other dimers with similar sequences but different poses
  • 2dxf/1/2:A/3:A 2cwk/2/1:A/2:A 2cwk/2/1:A/3:A 2cwk/2/1:B/2:B 2cwk/2/1:B/3:B 2cwk/2/2:A/3:A 2cwk/2/2:B/3:B 2dxd/1/1:A/2:A 2dxd/1/1:A/3:A 2dxd/1/1:B/2:B 2dxd/1/1:B/3:B 2dxd/1/2:A/3:A 2dxd/1/2:B/3:B 2dxd/2/1:A/2:A 2dxd/2/1:A/3:A 2dxd/2/1:B/2:B 2dxd/2/1:B/3:B 2dxd/2/2:A/3:A 2dxd/2/2:B/3:B 2dxd/2/4:A/5:A 2dxd/2/4:A/6:A 2dxd/2/4:B/5:B 2dxd/2/4:B/6:B 2dxd/2/5:A/6:A 2dxd/2/5:B/6:B 2dxe/1/1:A/2:A 2dxe/1/1:A/3:A 2dxe/1/1:B/2:B 2dxe/1/1:B/3:B 2dxe/1/2:A/3:A 2dxe/1/2:B/3:B 2dxf/1/1:A/2:A 2dxf/1/1:A/3:A 2dxf/1/1:B/2:B 2dxf/1/1:B/3:B 2dxf/1/2:B/3:B 2dy9/1/1:A/2:A 2dy9/1/1:A/3:A 2dy9/1/1:B/2:B 2dy9/1/1:B/3:B 2dy9/1/2:A/3:A 2dy9/1/2:B/3:B 2dya/1/1:A/2:A 2dya/1/1:A/3:A 2dya/1/1:B/2:B 2dya/1/1:B/3:B 2dya/1/2:A/3:A 2dya/1/2:B/3:B
  • 2dxd/2/1:A/6:A 2dxd/2/2:A/5:A 2dxd/2/3:A/4:A
    		•

    [Back to Home]