2e67/3/1:D/1:F

Sequences

>2e67-a3-m1-cD (length=263) [Search sequence]

DLLERLGLGGRRVLILHHDDLGLTHAQNGAYQALGLPTGSVMVPGAWASGVKGEDLGVHL
VLTSEWPAPRMRPLTEGESLRDEAGYFPESLEALWRKARAEEVERELKAQIQAAAKLFSP
THLDAHQGAVLRPDLAEVYLRLAEAYRLVPLVPESLEGLGVPPPFLPELERLLYETPFPQ
VRFLDPYGLPPEERLGFYLDLAHLPPGLYYLVHHSALPTPEGRALPDWPTREADYFALSH
PEVRRVLAEFHPLTWRAVREALF

>2e67-a3-m1-cF (length=263) [Search sequence]

Structure information

PDB ID	2e67 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the hypothetical protein TTHB029 from Thermus thermophilus HB8
Assembly ID	3
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0
PubMed citation	18177738

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	F
UniProt accession	Q53WD3	Q53WD3
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:2e67D	BioLiP:2e67F

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2e67-a3-m1-cD_2e67-a3-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2e67-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2e67/1/1:A/1:B 2e67/2/1:C/1:E