2e6x/1/1:A/2:A

Sequences
>2e6x-a1-m1-cA (length=66) [Search sequence]
EKDLLDKLGQHLVWRGRAEDEDVLVVRVGLASATPRFRELPRLLNLPEAERRLVQEGRVR
VEWVEE
>2e6x-a1-m2-cA (length=66) [Search sequence]
EKDLLDKLGQHLVWRGRAEDEDVLVVRVGLASATPRFRELPRLLNLPEAERRLVQEGRVR
VEWVEE
Structure information
PDB ID 2e6x (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of TT1592 from Thermus thermophilus HB8
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q5SIT3 Q5SIT3
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2e6x-a1-m1-cA_2e6x-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2e6x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2e6x/2/1:B/1:D 2e6x/3/1:C/2:C

[Back to Home]